PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA002364-PA
Common NameOsI_00469
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 275aa    MW: 30826.1 Da    PI: 6.6802
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA002364-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.7e-181660147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r rW++eE+e+++da  ++G + Wk+I +++g ++t  q++s+ qky
  BGIOSGA002364-PA 16 RERWSEEEHERFLDALIMYGRD-WKKIEEHVG-TKTTIQIRSHAQKY 60
                      78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.57E-181066IPR009057Homeodomain-like
PROSITE profilePS5129420.7691165IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-91367IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-181463IPR006447Myb domain, plants
SMARTSM007171.3E-121563IPR001005SANT/Myb domain
PfamPF002491.9E-141660IPR001005SANT/Myb domain
CDDcd001671.38E-101861No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MPGKKARKPY TITKPRERWS EEEHERFLDA LIMYGRDWKK IEEHVGTKTT IQIRSHAQKY  60
FLKVQKMGLA AGLPPQYPRR RLVMQQQQSS PAGSSSVAAP AILHGQPQCL PPHHNVAVQS  120
SIDMQNLEWA STSGAAAWGD HHGLIEPTAA FDSFPGESSF MGAASFSNMS MDWTGTTSEM  180
VTASIVQDET IELPLSPDDM QFAQVYRFIG DIFDPDSPCP VETHLQKLKN MDVITVKTIL  240
LVLRNLEDNL LSPQFEPIRR LLSTYDPNRG LSGHL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.316520.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329921780.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1069690.0AK106969.1 Oryza sativa Japonica Group cDNA clone:002-119-G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646001.11e-180PREDICTED: protein REVEILLE 8
TrEMBLA2WKV80.0A2WKV8_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA002364-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.12e-51MYB_related family protein